Going back to the garden/gotto go now


IMAGINE

"WE ARE STARDUST:
we are golden ..."
{and we got to get ourselves back
to the garden!}

About
the importance
and futility of reading and writing
{among other things
in myDi!}?

All words
about life must pass
thru nature to eternity
and the mystery of this transition
might be regarded
as the subject-matter
of myDi ...

In other words:
the discoveries of modern language
and sciences
have provided an almost uncanny
vindication of human myDi-stories thru the ages,
for now we know
that thru all nature's forms and processes,
its substance is eternal,
and that just as particles formed billions of years ago
have passed from interstellar space,
into our bodies,
from where they will return again
to their cosmic source,
our eternal myDi-stories are formed
essentially
by this same kind
of process.

This understanding
of natural story-telling
- as a succession of forms assumed by eternal elements -
emerged off and on during the past hundred years or so, when all kinds
of theories about the nature of 'our' myDi-universe,
and the equivalence of matter and energy
took shape, and it stands as arguably
{one of?} the greatest single
achievements of
human thought ...

MyDi is
also an attempt
to describe our long and complex process
of discovery that lies behind this achievement,
and to show how our readers and writers
have tried for countless centuries
to build all kinds of bridges between nature
and eternity ...

Today
we define
science by its methodology,
its critical examination of our myDi-world,
its language of measurement, experiment and deduction,
and its attempt to formulate general 'laws' which describe the way
we behave {feel
and think} ...

But this view
of our natural history is largely created
in the last centuries?

For
thousands of years,
in a myriad of different cultures,
'our' myDi-science would have been defined not by its method
but by its content,
that it was engaged in constructing by describing a set of beliefs
about 'our' nature and
'its' workings.

For this
myDi-activity,
'natural philosophy' was a better term than 'science':
seen in this light, the history of human existence becomes an inconclusive
discipline that is central to myDi-man's
entire intellectual
history?

The historian
of myDi-science cannot proceed by searching the past
for anticipations of modern ideas;
indeed he adopts the model of myDi-science
as answering questions about our world and our individual place in it,
and asks how these questions
were answered
in the past.

How
have men and women
explained the richness of living in this world,
the processes of disease and death,
the movements of the heavens,
the cycle of the seasons,
and thousands of other
questions?

This historical myDi-study
leads inevitably to a point of fundamental interest:
when did 'scientific descriptive thought' as we know it
first emerge and become dominant over other forms of 'thought'
about nature and man?

The difficulties
in finding exact answers to these questions
suggest that the history of our myDi-science, like that of other forms
of 'art', is not a simple progression from lower to higher,
but a sequence of responses to the world,
conditioned by historical circumstances,
and having the central questions of
our natural existence always
at its heart!

We'll
dream about it
and tomorrow
we might possibly see
where it will
lead us?

liefdesverdrietgemeenverwardgaap!bah!nahnahverdrietigcool!erg vrolijkknipoogvrolijkverliefdvrolijkknipoogerg vrolijkcool!verdrietignahnahbah!gaap!verwardgemeenliefdesverdriet
engel
19 jul 2004 - bewerkt op 16 jan 2008 - meld ongepast verhaal
Weet je zeker dat je dit verhaal wilt rapporteren? Ja | Nee
Profielfoto van Asih
Asih, man, 81 jaar
   
Log in om een reactie te plaatsen.   vorige volgende